Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Derlin-2.2 (DER2.2)

This Recombinant Zea mays Derlin-2.2 (DER2.2) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Derlin-2.2, ZmDerlin2-2

UniProt

Q4G2J3

Expression Region

1-249

Origin

Zea mays (Maize)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQAVEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNF LYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTGIVLIGGMIPYI SETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTW VDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPNAGIGAGARFG AIGVDPQAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNMT3L (C-term) Rabbit Polyclonal Antibody
AP11060PU-N 400 µL

DNMT3L (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotin X
TRC-B395670-500MG 500 mg

Biotin X

Sign In for Pricing
View Details
TrkB (NTRK2) pTyr705 Rabbit Polyclonal Antibody
AP08028PU-N 100 µL

TrkB (NTRK2) pTyr705 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CLEC14A/EGFR-5 Protein (His Tag)
PKSM040750 50 µg

Recombinant Mouse CLEC14A/EGFR-5 Protein (His Tag)

Sign In for Pricing
View Details
Human PTGES3L activation kit by CRISPRa
GA119407 1 Kit

Human PTGES3L activation kit by CRISPRa

Sign In for Pricing
View Details
PDK2 Antibody
8C18101-AAT 50 µg

PDK2 Antibody

Sign In for Pricing
View Details