Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Derlin-2.1 (DER2.1)

This Recombinant Zea mays Derlin-2.1 (DER2.1) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Derlin-2.1, ZmDerlin2-1

UniProt

Q4G2J4

Expression Region

1-249

Origin

Zea mays (Maize)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQAVEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNF LYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTSIVLIGGMIPYI SETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTW VDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPNAGIGAGARFG AMGLDPQAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM4, CT (ACSM4, Acyl-coenzyme A synthetase ACSM4, mitochondrial, Acyl-CoA synthetase medium-chain family member 4) (Azide free) (HRP)
MBS6271160-01 0.2 mL

ACSM4, CT (ACSM4, Acyl-coenzyme A synthetase ACSM4, mitochondrial, Acyl-CoA synthetase medium-chain family member 4) (Azide free) (HRP)

Sign In for Pricing
View Details
ACSM4, CT (ACSM4, Acyl-coenzyme A synthetase ACSM4, mitochondrial, Acyl-CoA synthetase medium-chain family member 4) (Azide free) (HRP)
MBS6271160-02 5x 0.2 mL

ACSM4, CT (ACSM4, Acyl-coenzyme A synthetase ACSM4, mitochondrial, Acyl-CoA synthetase medium-chain family member 4) (Azide free) (HRP)

Sign In for Pricing
View Details
RPL26P35 sgRNA CRISPR Lentivector (Human) (Target 3)
K1952104 1.0 µg DNA

RPL26P35 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
RhoGDI (Rho Guanine Dissociation Inhibitor) (MaxLight 750) discontinued
R1998-20-ML750 100 µL

RhoGDI (Rho Guanine Dissociation Inhibitor) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SCRN2 Protein Vector (Mouse) (pPM-C-His)
PV227153 500 ng

SCRN2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
DIABLO Rabbit pAb
MBS8544994-01 0.1 mL

DIABLO Rabbit pAb

Sign In for Pricing
View Details