Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Derlin-2.1 (DER2.1)

This Recombinant Zea mays Derlin-2.1 (DER2.1) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Derlin-2.1, ZmDerlin2-1

UniProt

Q4G2J4

Expression Region

1-249

Origin

Zea mays (Maize)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQAVEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNF LYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTSIVLIGGMIPYI SETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTW VDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPNAGIGAGARFG AMGLDPQAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUCKS1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
32268151 3x 1.0 µg DNA

NUCKS1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
N- (2-Chlorophenyl) glycine
GAA96149-01 250 mg

N- (2-Chlorophenyl) glycine

Sign In for Pricing
View Details
N- (2-Chlorophenyl) glycine
GAA96149-02 500 mg

N- (2-Chlorophenyl) glycine

Sign In for Pricing
View Details
N- (2-Chlorophenyl) glycine
GAA96149-03 1000 mg

N- (2-Chlorophenyl) glycine

Sign In for Pricing
View Details
BACE1 Monoclonal Antibody, Cy3 Conjugated
bsm-63071R-Cy3 100 µL

BACE1 Monoclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
DENND1B Protein Vector (Human) (pPB-C-His)
PV012165 500 ng

DENND1B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details