Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-7 (Tspan7)

This Recombinant Mouse Tetraspanin-7 (Tspan7) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Tetraspanin-7, Tspan-7, Cell surface glycoprotein A15, PE31, TALLA homolog, Transmembrane 4 superfamily member 2, CD_antigen= CD231

UniProt

Q62283

Expression Region

1-249

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPY VLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTF LRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETD CNPLDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF ITANQYEMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF3A Recombinant Antibody, Biotin Conjugated
bsm-61570R-Biotin-TR 20 µL

KIF3A Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
TMEM104 (Transmembrane Protein 104, FLJ00021, FLJ20255) (AP)
MBS6403034-01 0.1 mL

TMEM104 (Transmembrane Protein 104, FLJ00021, FLJ20255) (AP)

Sign In for Pricing
View Details
TMEM104 (Transmembrane Protein 104, FLJ00021, FLJ20255) (AP)
MBS6403034-02 5x 0.1 mL

TMEM104 (Transmembrane Protein 104, FLJ00021, FLJ20255) (AP)

Sign In for Pricing
View Details
N- ((cyclohexylamino) carbonylamino) -2- (2-thienyl) ethanamide
ELB82498 250 mg

N- ((cyclohexylamino) carbonylamino) -2- (2-thienyl) ethanamide

Sign In for Pricing
View Details
Hsa-miR-150-3p agomir
HY-R00300A-01 5 nmol

Hsa-miR-150-3p agomir

Sign In for Pricing
View Details
Hsa-miR-150-3p agomir
HY-R00300A-02 20 nmol

Hsa-miR-150-3p agomir

Sign In for Pricing
View Details