Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-7 (Tspan7)

This Recombinant Mouse Tetraspanin-7 (Tspan7) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Tetraspanin-7, Tspan-7, Cell surface glycoprotein A15, PE31, TALLA homolog, Transmembrane 4 superfamily member 2, CD_antigen= CD231

UniProt

Q62283

Expression Region

1-249

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPY VLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTF LRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETD CNPLDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF ITANQYEMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3, Phosphorylated (Ser10) (H3 Histone, Family 3A) (FITC)
MBS6480747-01 0.1 mL

Histone H3, Phosphorylated (Ser10) (H3 Histone, Family 3A) (FITC)

Sign In for Pricing
View Details
Histone H3, Phosphorylated (Ser10) (H3 Histone, Family 3A) (FITC)
MBS6480747-02 5x 0.1 mL

Histone H3, Phosphorylated (Ser10) (H3 Histone, Family 3A) (FITC)

Sign In for Pricing
View Details
Rnf168 (NM_027355) Mouse Tagged ORF Clone
MR208516 10 µg

Rnf168 (NM_027355) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Canine Heat Shock Protein 70, HSP-70 ELISA Kit
MBS7261890-01 48 Well

Canine Heat Shock Protein 70, HSP-70 ELISA Kit

Sign In for Pricing
View Details
Canine Heat Shock Protein 70, HSP-70 ELISA Kit
MBS7261890-02 96 Well

Canine Heat Shock Protein 70, HSP-70 ELISA Kit

Sign In for Pricing
View Details
Canine Heat Shock Protein 70, HSP-70 ELISA Kit
MBS7261890-03 5x 96 Well

Canine Heat Shock Protein 70, HSP-70 ELISA Kit

Sign In for Pricing
View Details