Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin synthase (cobS)

This Recombinant Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q7VEN6

Expression Region

1-249

Origin

Mycobacterium bovis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWAGAQVFGPSSP LSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALAVMRDGSTGPFGVAAVVLVIA LQGLAFATLTTVGIAGITLAVLSGRVTAVLVCRRSVPAAHGSTLGSRVAGTQPAPVVAAW LAVLLAVSVPAGPRPWQGPIAVLVAVTAGAALAAHCVHRFGGVTGDVLGSAIELSTTVSA VTLAGLARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC1 Human Over-expression Lysate
orb1355408 100 µg

ERCC1 Human Over-expression Lysate

Sign In for Pricing
View Details
MED23 3'UTR GFP Stable Cell Line
TU063194 1.0 mL

MED23 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GNF-5 (Bcr-Abl inhibitor)
SC1126-5mg 5 mg

GNF-5 (Bcr-Abl inhibitor)

Sign In for Pricing
View Details
Recombinant Rat Protein MIS12 homolog (Mis12)
MBS1439897-01 0.02 mg (E-Coli)

Recombinant Rat Protein MIS12 homolog (Mis12)

Sign In for Pricing
View Details
Recombinant Rat Protein MIS12 homolog (Mis12)
MBS1439897-02 0.1 mg (E-Coli)

Recombinant Rat Protein MIS12 homolog (Mis12)

Sign In for Pricing
View Details
Recombinant Rat Protein MIS12 homolog (Mis12)
MBS1439897-03 0.02 mg (Yeast)

Recombinant Rat Protein MIS12 homolog (Mis12)

Sign In for Pricing
View Details