Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis Membrane protein insertase YidC 1 (yidC1)

This Recombinant Lactococcus lactis subsp. lactis Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 21-269.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q9CJ72

Expression Region

21-269

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGTTAVTSSSTNLWDQIVYGFAQVIRFLSFGGLTGVGIILFTIVIRAALLPLMNIQIKSS QRMQEIQPEIKKIQAKYPSKDMESRRLMNEEIQKLYAENKVNPYMGCLPLVVQMPVLWAL YQALSRVDFLKHGTFLWFEIGAKDPTFILPILAAVFTFLSSYLMMKSAPERNAMTTSMTY IMPIFILIMGVNFAAGIALYWVISNAFQVFQTMLLANPYKIIAAREAKVQVEKDKIKARE KALKKARKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quinoline-8-boronic acid
OR4993-01 5 g

Quinoline-8-boronic acid

Sign In for Pricing
View Details
Quinoline-8-boronic acid
OR4993-02 500 g

Quinoline-8-boronic acid

Sign In for Pricing
View Details
Mouse Monoclonal FPRL1/FPR2 Antibody (304405) [DyLight 680]
FAB3479Y 0.1 mL

Mouse Monoclonal FPRL1/FPR2 Antibody (304405) [DyLight 680]

Sign In for Pricing
View Details
Plant Lin-28 Homolog A (LIN28A) ELISA Kit
MBS9380484 Inquire

Plant Lin-28 Homolog A (LIN28A) ELISA Kit

Sign In for Pricing
View Details
ERICH1 ORF Vector (Human) (pORF)
19429011 1.0 µg DNA

ERICH1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral human LRRC43 sgRNA gene knockout kit - Lentiviral human LRRC43 sgRNA gene knockout kit (100)
GTR15355317 1 Vial

Lentiviral human LRRC43 sgRNA gene knockout kit - Lentiviral human LRRC43 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details