Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis Membrane protein insertase YidC 1 (yidC1)

This Recombinant Lactococcus lactis subsp. lactis Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 21-269.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q9CJ72

Expression Region

21-269

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGTTAVTSSSTNLWDQIVYGFAQVIRFLSFGGLTGVGIILFTIVIRAALLPLMNIQIKSS QRMQEIQPEIKKIQAKYPSKDMESRRLMNEEIQKLYAENKVNPYMGCLPLVVQMPVLWAL YQALSRVDFLKHGTFLWFEIGAKDPTFILPILAAVFTFLSSYLMMKSAPERNAMTTSMTY IMPIFILIMGVNFAAGIALYWVISNAFQVFQTMLLANPYKIIAAREAKVQVEKDKIKARE KALKKARKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-CMV-TRAF3-CopGFP-Puro Plasmid
PVT54633 2 µg

pLV3-CMV-TRAF3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
TESPA1 Adenovirus (Human)
46515051 1.0 mL

TESPA1 Adenovirus (Human)

Sign In for Pricing
View Details
Feline calicivirus capsid protein 1
E57V1477 50 µg

Feline calicivirus capsid protein 1

Sign In for Pricing
View Details
SOX11 Antibody
MBS8591311-01 0.1 mg

SOX11 Antibody

Sign In for Pricing
View Details
SOX11 Antibody
MBS8591311-02 0.1 mL (AF405L)

SOX11 Antibody

Sign In for Pricing
View Details
SOX11 Antibody
MBS8591311-03 0.1 mL (AF405S)

SOX11 Antibody

Sign In for Pricing
View Details