Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P08444

Expression Region

1-249

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLLELSSVLPLAELEVGQHFYWQIGNYRLHGQVFLTSWFVIAALVVLSLLANRNLQRI PSGLQNFMEYVLDFIRNLARTQIGEKEYRPWVPFIGTLFLFIFLSNWSGALIPWKLIKLP SGELAAPTSDINTTVALALLTSLAYFYAGFSRKGLGYFGNYVHPTPVMLPFKILEDFTKP LSLSFRLFGNILADELVVAVLVLLVPLFVPLPAMILGLFTSAIQALIFATLAASYIGEAV EEHGEEHAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (34BE12), CF647 conjugate, 0.1mg/mL
BNC470446-500 1x 500 µL

Cytokeratin, HMW (34BE12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Diamine acetyltransferase 1 (SAT1)
orb1651839-01 20 µg

Recombinant Human Diamine acetyltransferase 1 (SAT1)

Sign In for Pricing
View Details
Recombinant Human Diamine acetyltransferase 1 (SAT1)
orb1651839-02 100 µg

Recombinant Human Diamine acetyltransferase 1 (SAT1)

Sign In for Pricing
View Details
Recombinant Human Diamine acetyltransferase 1 (SAT1)
orb1651839-03 1 mg

Recombinant Human Diamine acetyltransferase 1 (SAT1)

Sign In for Pricing
View Details
STAP1 ORF Vector (Human) (pORF)
ORF010104 1.0 µg DNA

STAP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
6030446N20RIK Adenovirus (Mouse)
10820054 1.0 mL

6030446N20RIK Adenovirus (Mouse)

Sign In for Pricing
View Details