Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P08444

Expression Region

1-249

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLLELSSVLPLAELEVGQHFYWQIGNYRLHGQVFLTSWFVIAALVVLSLLANRNLQRI PSGLQNFMEYVLDFIRNLARTQIGEKEYRPWVPFIGTLFLFIFLSNWSGALIPWKLIKLP SGELAAPTSDINTTVALALLTSLAYFYAGFSRKGLGYFGNYVHPTPVMLPFKILEDFTKP LSLSFRLFGNILADELVVAVLVLLVPLFVPLPAMILGLFTSAIQALIFATLAASYIGEAV EEHGEEHAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKD2 (phospho Ser876) Antibody
A0808-01 50 μL

PKD2 (phospho Ser876) Antibody

Sign In for Pricing
View Details
PKD2 (phospho Ser876) Antibody
A0808-02 100 µL

PKD2 (phospho Ser876) Antibody

Sign In for Pricing
View Details
Mouse Protein FAM198A, Fam198a ELISA KIT
ELI-32763m 96 Tests

Mouse Protein FAM198A, Fam198a ELISA KIT

Sign In for Pricing
View Details
ETO Double Nickase Plasmid (h)
sc-401755-NIC 20 µg

ETO Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Anti-Doublecortin Like Kinase 1 (DCLK1) Polyclonal antibody
FY-AB38841-01 1 mL

Anti-Doublecortin Like Kinase 1 (DCLK1) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Doublecortin Like Kinase 1 (DCLK1) Polyclonal antibody
FY-AB38841-02 100 µL

Anti-Doublecortin Like Kinase 1 (DCLK1) Polyclonal antibody

Sign In for Pricing
View Details