Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P08444

Expression Region

1-249

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLLELSSVLPLAELEVGQHFYWQIGNYRLHGQVFLTSWFVIAALVVLSLLANRNLQRI PSGLQNFMEYVLDFIRNLARTQIGEKEYRPWVPFIGTLFLFIFLSNWSGALIPWKLIKLP SGELAAPTSDINTTVALALLTSLAYFYAGFSRKGLGYFGNYVHPTPVMLPFKILEDFTKP LSLSFRLFGNILADELVVAVLVLLVPLFVPLPAMILGLFTSAIQALIFATLAASYIGEAV EEHGEEHAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MCM2 Antibody (MCM2/3678) [Alexa Fluor 405]
NBP3-14118AF405 0.1 mL

Mouse Monoclonal MCM2 Antibody (MCM2/3678) [Alexa Fluor 405]

Sign In for Pricing
View Details
VPS50 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7B8]
TA812029BM 100 µL

VPS50 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7B8]

Sign In for Pricing
View Details
Rat INS1 siRNA
abx920658-01 15 nmol

Rat INS1 siRNA

Sign In for Pricing
View Details
Rat INS1 siRNA
abx920658-02 30 nmol

Rat INS1 siRNA

Sign In for Pricing
View Details
Azilsartan Impurity K
RM-A261911-01 10 mg

Azilsartan Impurity K

Sign In for Pricing
View Details
Azilsartan Impurity K
RM-A261911-02 25 mg

Azilsartan Impurity K

Sign In for Pricing
View Details