Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 1 (yidC1)

This Recombinant Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 26-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

P65631

Expression Region

26-275

Origin

Streptococcus pyogenes serotype M1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSS QKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIAL FQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIY VMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRER RARKKAMKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Niemann Pick C1 Antibody / NPC1
RQ8133 100 µg

Niemann Pick C1 Antibody / NPC1

Sign In for Pricing
View Details
L-Leucine-d10
TRC-L330638-50MG 50 mg

L-Leucine-d10

Sign In for Pricing
View Details
ARMH1 (NM_001145636) Human Over-expression Lysate
LC428943 20 µg

ARMH1 (NM_001145636) Human Over-expression Lysate

Sign In for Pricing
View Details
Factor XI (F11) (NM_000128) Human Recombinant Protein
TP313056M 100 µg

Factor XI (F11) (NM_000128) Human Recombinant Protein

Sign In for Pricing
View Details
EAAT1 (SLC1A3) (197-208) Goat Polyclonal Antibody
AP32158PU-N 100 µg

EAAT1 (SLC1A3) (197-208) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Adrenal gland
CR561782 5 µg

Tissue Total RNA, Adrenal gland

Sign In for Pricing
View Details