Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 1 (yidC1)

This Recombinant Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 26-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

P65631

Expression Region

26-275

Origin

Streptococcus pyogenes serotype M1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSS QKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIAL FQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIY VMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRER RARKKAMKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16/CD32 Rat Monoclonal Antibody [Clone ID: 93]
AM08040FC-N 500 µg

CD16/CD32 Rat Monoclonal Antibody [Clone ID: 93]

Sign In for Pricing
View Details
FITC Conjugated Colchicum autumnale Lectin (Meadow Saffron) -CA-
F-8004-1 1 mg

FITC Conjugated Colchicum autumnale Lectin (Meadow Saffron) -CA-

Sign In for Pricing
View Details
Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), CF405S conjugate, 0.1mg/mL
BNC043781-100 1x 100 µL

Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Puberulic Acid
TRC-P196705-5MG 5 mg

Puberulic Acid

Sign In for Pricing
View Details
Brilliant Sodium pIONeer - No wash sodium assay kit
2593255 2 Plates

Brilliant Sodium pIONeer - No wash sodium assay kit

Sign In for Pricing
View Details
Neurofilament (H+L) (NF421 + NFL736), CF568 conjugate, 0.1mg/mL
BNC680756-100 1x 100 µL

Neurofilament (H+L) (NF421 + NFL736), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details