Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 1 (yidC1)

This Recombinant Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 26-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

P65631

Expression Region

26-275

Origin

Streptococcus pyogenes serotype M1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSS QKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIAL FQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIY VMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRER RARKKAMKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM171 activation kit by CRISPRa
GA115221 1 Kit

Human TMEM171 activation kit by CRISPRa

Sign In for Pricing
View Details
N-Caproic Acid Isopropyl Ester
TRC-C175748-250MG 250 mg

N-Caproic Acid Isopropyl Ester

Sign In for Pricing
View Details
IL2 Antibody
KC-341-01 50 μL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-341-02 100 µL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-341-03 1 mL

IL2 Antibody

Sign In for Pricing
View Details
LOC341583 Human qPCR Primer Pair (XM_292142)
HP221466 200 Reactions

LOC341583 Human qPCR Primer Pair (XM_292142)

Sign In for Pricing
View Details