Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 1 (yidC1)

This Recombinant Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 26-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q8P2P8

Expression Region

26-275

Origin

Streptococcus pyogenes serotype M18

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSS QKMQDIQPELRELQKKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIAL FQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIY VMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRER RARKKAMKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP6R3 Antibody
DF14649-01 100 µL

PPP6R3 Antibody

Sign In for Pricing
View Details
PPP6R3 Antibody
DF14649-02 200 µL

PPP6R3 Antibody

Sign In for Pricing
View Details
Itsn1 ORF Vector (Mouse) (pORF)
ORF048194 1.0 µg DNA

Itsn1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human KANSL1 Pre-designed siRNA Set A
SI007939A 1 Each

Human KANSL1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ERAP1 (Endoplasmic Reticulum Aminopeptidase 1, ALAP, A-LAP, ARTS1, ERAAP, APPILS, ARTS-1, ERAAP1, PILSAP, PILS-AP) (FITC)
MBS6416071-01 0.1 mL

ERAP1 (Endoplasmic Reticulum Aminopeptidase 1, ALAP, A-LAP, ARTS1, ERAAP, APPILS, ARTS-1, ERAAP1, PILSAP, PILS-AP) (FITC)

Sign In for Pricing
View Details
ERAP1 (Endoplasmic Reticulum Aminopeptidase 1, ALAP, A-LAP, ARTS1, ERAAP, APPILS, ARTS-1, ERAAP1, PILSAP, PILS-AP) (FITC)
MBS6416071-02 5x 0.1 mL

ERAP1 (Endoplasmic Reticulum Aminopeptidase 1, ALAP, A-LAP, ARTS1, ERAAP, APPILS, ARTS-1, ERAAP1, PILSAP, PILS-AP) (FITC)

Sign In for Pricing
View Details