Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P63654

Expression Region

1-250

Origin

Mycobacterium tuberculosis

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETILAAQIEVGEHHTATWLGMTVNTDTVLSTAIAGLIVIALAFYLRAKVTSTDVPGGV QLFFEAITIQMRNQVESAIGMRIAPFVLPLAVTIFVFILISNWLAVLPVQYTDKHGHTTE LLKSAAADINYVLALALFVFVCYHTAGIWRRGIVGHPIKLLKGHVTLLAPINLVEEVAKP ISLSLRLFGNIFAGGILVALIALFPPYIMWAPNAIWKAFDLFVGAIQAFIFALLTILYFS QAMELEEEHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMPR2 (NM_001002001) Human Over-expression Lysate
LC424315 20 µg

GMPR2 (NM_001002001) Human Over-expression Lysate

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (ICO-30), CF640R conjugate, 0.1mg/mL
BNC400364-100 1x 100 µL

Human IgM Immunoglobulin (ICO-30), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APOA5 Human, HEK
OM296964-01 10 µg

APOA5 Human, HEK

Sign In for Pricing
View Details
APOA5 Human, HEK
OM296964-02 2 µg

APOA5 Human, HEK

Sign In for Pricing
View Details
APOA5 Human, HEK
OM296964-03 1 mg

APOA5 Human, HEK

Sign In for Pricing
View Details