Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium ulcerans ATP synthase subunit a (atpB)

This Recombinant Mycobacterium ulcerans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A0PUK6

Expression Region

1-250

Origin

Mycobacterium ulcerans (strain Agy99)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTASILAAQIEVGEHHTATWLCMTVNTDTVLSTAIAALIVLALAFYLRSKVTSTAVPGGV QLFFEAITIQMRGQVESAIGMRIAPFVLPLAVTIFVFILISNWLSVLPVQYTDEHGQTTE LLKPAAADINYVLALALFVFVCYHAAGIWRRGIVGHPIKLLKGHVAILAPINLVEEIAKP ISLSLRLFGNIFAGSILVALIALFPPYIMWAPNAIWKSFDLFVGAIQAFIFALLTILYFS QAMELEEDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTAP (Tumor Suppressor Marker) (MTAP/3137R), CF647 conjugate, 0.1mg/mL
BNC473137-500 1x 500 µL

MTAP (Tumor Suppressor Marker) (MTAP/3137R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmem126a Mouse Gene Knockout Kit (CRISPR)
KN517710 1 Kit

Tmem126a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPS9 Rabbit Polyclonal Antibody
TA392825 100 µL

RPS9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ccl11 (NM_011330) Mouse Tagged ORF Clone
MG200278 10 µg

Ccl11 (NM_011330) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ANHX (NM_001191054) Human Over-expression Lysate
LC434195 20 µg

ANHX (NM_001191054) Human Over-expression Lysate

Sign In for Pricing
View Details
Fmoc-Cys (StBu) Wang Resin LL
HLL0751501309.5G 5 g

Fmoc-Cys (StBu) Wang Resin LL

Sign In for Pricing
View Details