Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium ulcerans ATP synthase subunit a (atpB)

This Recombinant Mycobacterium ulcerans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A0PUK6

Expression Region

1-250

Origin

Mycobacterium ulcerans (strain Agy99)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTASILAAQIEVGEHHTATWLCMTVNTDTVLSTAIAALIVLALAFYLRSKVTSTAVPGGV QLFFEAITIQMRGQVESAIGMRIAPFVLPLAVTIFVFILISNWLSVLPVQYTDEHGQTTE LLKPAAADINYVLALALFVFVCYHAAGIWRRGIVGHPIKLLKGHVAILAPINLVEEIAKP ISLSLRLFGNIFAGSILVALIALFPPYIMWAPNAIWKSFDLFVGAIQAFIFALLTILYFS QAMELEEDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF405S conjugate, 0.1mg/mL
BNC042130-500 1x 500 µL

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTPN23 Antibody
KC-41952-01 50 μL

PTPN23 Antibody

Sign In for Pricing
View Details
PTPN23 Antibody
KC-41952-02 100 µL

PTPN23 Antibody

Sign In for Pricing
View Details
PTPN23 Antibody
KC-41952-03 1 mL

PTPN23 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: left upper lobe
CS712350 5x 5 µm

Tissue FFPE Sections, Lung: left upper lobe

Sign In for Pricing
View Details
CAMKV Human Gene Knockout Kit (CRISPR)
KN402441 1 Kit

CAMKV Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details