Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 1 (yidC1)

This Recombinant Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 26-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

P0DC86

Expression Region

26-275

Origin

Streptococcus pyogenes serotype M3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSS QKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIAL FQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIY VMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRER RARKKAMKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexacyclen
TRC-H290763-250MG 250 mg

Hexacyclen

Sign In for Pricing
View Details
CXorf66 (NM_001013403) Human Over-expression Lysate
LC422968 20 µg

CXorf66 (NM_001013403) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Chlorobenzoic anhydride
TRC-C427630-500MG 500 mg

4-Chlorobenzoic anhydride

Sign In for Pricing
View Details
COX16 Polyclonal Antibody
E-AB-10071-01 20 µL

COX16 Polyclonal Antibody

Sign In for Pricing
View Details
COX16 Polyclonal Antibody
E-AB-10071-02 60 µL

COX16 Polyclonal Antibody

Sign In for Pricing
View Details
COX16 Polyclonal Antibody
E-AB-10071-03 120 µL

COX16 Polyclonal Antibody

Sign In for Pricing
View Details