Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 1 (yidC1)

This Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 26-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

P0DC87

Expression Region

26-275

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSS QKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIAL FQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIY VMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRER RARKKAMKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem160 Mouse Gene Knockout Kit (CRISPR)
KN517743 1 Kit

Tmem160 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SUCLA2 Rabbit Polyclonal Antibody
TA370998 100 µL

SUCLA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF740 conjugate, 0.1mg/mL
BNC742043-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS714270 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Usp15 Mouse Gene Knockout Kit (CRISPR)
KN518770 1 Kit

Usp15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ccdc150 Mouse Gene Knockout Kit (CRISPR)
KN502668 1 Kit

Ccdc150 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details