Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 1 (yidC1)

This Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 26-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

P0DC87

Expression Region

26-275

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSS QKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIAL FQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIY VMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRER RARKKAMKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromopalmitic Acid
TRC-B182637-1G 1 g

2-Bromopalmitic Acid

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), CF405S conjugate, 0.1mg/mL
BNC042173-100 1x 100 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Triclabendazole Sulfone-D3
TRC-T773827-1MG 1 mg

Triclabendazole Sulfone-D3

Sign In for Pricing
View Details
Mouse Cd3e activation kit by CRISPRa
GA200622 1 Kit

Mouse Cd3e activation kit by CRISPRa

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (MS4A1/3410), CF568 conjugate, 0.1mg/mL
BNC683410-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (MS4A1/3410), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APBB1IP Antibody
OC-268-01 50 μL

APBB1IP Antibody

Sign In for Pricing
View Details