Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 1 (yidC1)

This Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 26-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

P0DC87

Expression Region

26-275

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSS QKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIAL FQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIY VMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRER RARKKAMKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
AP06547PU-N 100 µg

NMDAR1 (GRIN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
mib1 Rabbit Polyclonal Antibody
AP54909SU-N 200 µL

mib1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zilpaterol-13C3 Hydrochloride
TRC-Z430001-100MG 100 mg

Zilpaterol-13C3 Hydrochloride

Sign In for Pricing
View Details
Colloidal Gold Conjugated Agaricus bisporus Lectin (Mushroom) -ABA-,  40nm
GP-5001-40 1 mL

Colloidal Gold Conjugated Agaricus bisporus Lectin (Mushroom) -ABA-, 40nm

Sign In for Pricing
View Details
MET Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]
TA805996AM 100 µL

MET Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]

Sign In for Pricing
View Details
Benzyl 2-Acetamido-2-deoxy-4-O-Beta-D-galactofuranosyl-Alpha-D-glucopyranoside
TRC-B212510-5MG 5 mg

Benzyl 2-Acetamido-2-deoxy-4-O-Beta-D-galactofuranosyl-Alpha-D-glucopyranoside

Sign In for Pricing
View Details