Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis ATP synthase subunit a (atpB)

This Recombinant Anabaena variabilis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3M9V5

Expression Region

1-251

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNFLNFYSVPLAELEVGKHLYWQIGNLKLHGQVFLTSWFVIGVLVLASVAASSNVKRIP SGIQNLLEYALEFIRDLAKNQIGEKEYRPWVPFVGTLFLFIFVSNWSGALVPFKLIHLPE GELAAPTSDINTTVALALLTSLAYFYAGFSKKGLGYFGNYVQPVSFMLPFKIIEDFTKPL SLSFRLFGNILADELVVGVLVLLVPLFVPLPVMALGLFTSAIQALIFATLAAAYIGEAME DHHGEEHEEHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH9 Antibody
KC-320-01 50 μL

MYH9 Antibody

Sign In for Pricing
View Details
MYH9 Antibody
KC-320-02 100 µL

MYH9 Antibody

Sign In for Pricing
View Details
MYH9 Antibody
KC-320-03 1 mL

MYH9 Antibody

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF740 conjugate, 0.1mg/mL
BNC741176-500 1x 500 µL

EMI1 (EMI1/1176), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-ribo Phytosphingosine
TRC-P398990-25MG 25 mg

D-ribo Phytosphingosine

Sign In for Pricing
View Details
EEF2 Antibody
KC-6464-01 50 μL

EEF2 Antibody

Sign In for Pricing
View Details