Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Derlin-1 (DERL1)

This Recombinant Pongo abelii Derlin-1 (DERL1) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Derlin-1, Degradation in endoplasmic reticulum protein 1, Der1-like protein 1

UniProt

Q5R9W3

Expression Region

1-251

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATF YFPVGPGTGFLYLVNLYFLYHYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQL LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH NWGQGFRLGDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Plakophilin-3 Antibody (23E3/4) [Alexa Fluor 700]
NBP1-97674AF700 0.1 mL

Mouse Monoclonal Plakophilin-3 Antibody (23E3/4) [Alexa Fluor 700]

Sign In for Pricing
View Details
EGF Knockout Hela Polyclonal Cells
ARG40717 1 Million

EGF Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral human RAB14 sgRNA gene knockout kit - Lentiviral human RAB14 sgRNA gene knockout kit (plasmid)
GTR15380321 1 Vial

Lentiviral human RAB14 sgRNA gene knockout kit - Lentiviral human RAB14 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
KPNA5 (Importin Subunit alpha-6, Karyopherin Subunit alpha-5) (MaxLight 405) discontinued
128918-ML405 100 µL

KPNA5 (Importin Subunit alpha-6, Karyopherin Subunit alpha-5) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PITPNM1 Antibody (FITC)
orb242107-01 50 µg

PITPNM1 Antibody (FITC)

Sign In for Pricing
View Details
PITPNM1 Antibody (FITC)
orb242107-02 100 µg

PITPNM1 Antibody (FITC)

Sign In for Pricing
View Details