Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Derlin-1 (DERL1)

This Recombinant Pongo abelii Derlin-1 (DERL1) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Derlin-1, Degradation in endoplasmic reticulum protein 1, Der1-like protein 1

UniProt

Q5R9W3

Expression Region

1-251

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATF YFPVGPGTGFLYLVNLYFLYHYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQL LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH NWGQGFRLGDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin
553362 1 mg

Biotin

Sign In for Pricing
View Details
KCNJ6 Antibody (Center)
MBS9215167-01 0.08 mL

KCNJ6 Antibody (Center)

Sign In for Pricing
View Details
KCNJ6 Antibody (Center)
MBS9215167-02 0.4 mL

KCNJ6 Antibody (Center)

Sign In for Pricing
View Details
KCNJ6 Antibody (Center)
MBS9215167-03 5x 0.4 mL

KCNJ6 Antibody (Center)

Sign In for Pricing
View Details
FNDC1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-8460R-BF488 100 µL

FNDC1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Recombinant Vigna unguiculata Cell division control protein 2 homolog (CDC2)
MBS1011443-01 0.02 mg (E-Coli)

Recombinant Vigna unguiculata Cell division control protein 2 homolog (CDC2)

Sign In for Pricing
View Details