Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 1 (yidC1)

This Recombinant Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 21-271.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q8E6W4

Expression Region

21-271

Origin

Streptococcus agalactiae serotype III

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVSSHSATLWEQIVYAFAKSIQWLSFNHSIGLGIILFTLIIRAIMMPLYNMQMKSS QKMQEIQPRLKELQKKYPGKDPDSRLKLNDEMQSMYKAEGVNPYASVLPLLIQLPVLWAL FQALTRVSFLKVGTFLSLELSQPDPYYILPVLAALFTFLSTWLTNKAAVEKNIALTLMTY VMPFIILVTSFNFASGVVLYWTVSNAFQVFQILLLNNPYKIIKVREEAVRVAHEKEQRVK RAKRKASKKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD21 Antibody (CR2/7185R) [Alexa Fluor 488]
NBP3-21126AF488 0.1 mL

Rabbit Monoclonal CD21 Antibody (CR2/7185R) [Alexa Fluor 488]

Sign In for Pricing
View Details
Mouse MBP (Myelin Basic Protein) ELISA Kit
EKF58334 96 Tests

Mouse MBP (Myelin Basic Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse Tesk2 qPCR Primer Pair
QM59314S 200 Tests

Mouse Tesk2 qPCR Primer Pair

Sign In for Pricing
View Details
Granulin Recombinant Rabbit mAb
orb2323818-01 25 µL

Granulin Recombinant Rabbit mAb

Sign In for Pricing
View Details
Granulin Recombinant Rabbit mAb
orb2323818-02 50 µL

Granulin Recombinant Rabbit mAb

Sign In for Pricing
View Details
Granulin Recombinant Rabbit mAb
orb2323818-03 100 µL

Granulin Recombinant Rabbit mAb

Sign In for Pricing
View Details