Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 1 (yidC1)

This Recombinant Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 21-271.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q8E6W4

Expression Region

21-271

Origin

Streptococcus agalactiae serotype III

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGRGEVSSHSATLWEQIVYAFAKSIQWLSFNHSIGLGIILFTLIIRAIMMPLYNMQMKSS QKMQEIQPRLKELQKKYPGKDPDSRLKLNDEMQSMYKAEGVNPYASVLPLLIQLPVLWAL FQALTRVSFLKVGTFLSLELSQPDPYYILPVLAALFTFLSTWLTNKAAVEKNIALTLMTY VMPFIILVTSFNFASGVVLYWTVSNAFQVFQILLLNNPYKIIKVREEAVRVAHEKEQRVK RAKRKASKKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EDC3 Protein, His (Fc)-Avi-tagged
EDC3-801H 50 µg

Recombinant Human EDC3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Iron Metal Filings Fine
GPC5320-3Y 3 Kg

Iron Metal Filings Fine

Sign In for Pricing
View Details
LSM1 (NM_014462) Human Recombinant Protein
PROTO15116 20 µg

LSM1 (NM_014462) Human Recombinant Protein

Sign In for Pricing
View Details
FAM75D1-set siRNA/shRNA/RNAi Lentivector (Human)
20122091 4x 500 ng

FAM75D1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Anti-SR-alpha Antibody
CQA3135-01 30 µL

Anti-SR-alpha Antibody

Sign In for Pricing
View Details
Anti-SR-alpha Antibody
CQA3135-02 50 μL

Anti-SR-alpha Antibody

Sign In for Pricing
View Details