Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRI3-binding protein (BRI3BP)

This Recombinant Human BRI3-binding protein (BRI3BP) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

BRI3-binding protein, I3-binding protein, Cervical cancer 1 proto-oncogene-binding protein KG19, HCCRBP-1

UniProt

Q8WY22

Expression Region

1-251

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSL FGEDNVRAAQKFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSS SPARALLLVGVVLLAYWFLSLTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGE PENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNR VLESLDRSKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMX1B Antibody
MBS9405183-01 0.05 mL

LMX1B Antibody

Sign In for Pricing
View Details
LMX1B Antibody
MBS9405183-02 0.1 mL

LMX1B Antibody

Sign In for Pricing
View Details
LMX1B Antibody
MBS9405183-03 5x 0.1 mL

LMX1B Antibody

Sign In for Pricing
View Details
PPAP2A (Lipid Phosphate Phosphohydrolase 1, PAP2-alpha, Phosphatidate Phosphohydrolase Type 2a, Phosphatidic Acid Phosphatase 2a, PAP-2a, PAP2a, PPAP2A, LPP1) (HRP) discontinued
302661-HRP 200 µL

PPAP2A (Lipid Phosphate Phosphohydrolase 1, PAP2-alpha, Phosphatidate Phosphohydrolase Type 2a, Phosphatidic Acid Phosphatase 2a, PAP-2a, PAP2a, PPAP2A, LPP1) (HRP) discontinued

Sign In for Pricing
View Details
Vom2r49 Protein Vector (Rat) (pPB-C-His)
PV315822 500 ng

Vom2r49 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
2- ((Decyloxy) carbonyl) benzoic acid
OR1038510 100 mg

2- ((Decyloxy) carbonyl) benzoic acid

Sign In for Pricing
View Details