Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRI3-binding protein (BRI3BP)

This Recombinant Human BRI3-binding protein (BRI3BP) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

BRI3-binding protein, I3-binding protein, Cervical cancer 1 proto-oncogene-binding protein KG19, HCCRBP-1

UniProt

Q8WY22

Expression Region

1-251

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSL FGEDNVRAAQKFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSS SPARALLLVGVVLLAYWFLSLTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGE PENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNR VLESLDRSKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPA1 Recombinant Protein (Human)
OPCA04252-1MG 1 mg

TRPA1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Vmn1r184 AAV siRNA Pooled Vector
49588164 1.0 µg

Vmn1r184 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Bovine Death-associated protein 1 (DAP)
MBS1280726-01 0.02 mg (E-Coli)

Recombinant Bovine Death-associated protein 1 (DAP)

Sign In for Pricing
View Details
Recombinant Bovine Death-associated protein 1 (DAP)
MBS1280726-02 0.1 mg (E-Coli)

Recombinant Bovine Death-associated protein 1 (DAP)

Sign In for Pricing
View Details
Recombinant Bovine Death-associated protein 1 (DAP)
MBS1280726-03 0.02 mg (Yeast)

Recombinant Bovine Death-associated protein 1 (DAP)

Sign In for Pricing
View Details
Recombinant Bovine Death-associated protein 1 (DAP)
MBS1280726-04 0.1 mg (Yeast)

Recombinant Bovine Death-associated protein 1 (DAP)

Sign In for Pricing
View Details