Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRI3-binding protein (BRI3BP)

This Recombinant Human BRI3-binding protein (BRI3BP) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

BRI3-binding protein, I3-binding protein, Cervical cancer 1 proto-oncogene-binding protein KG19, HCCRBP-1

UniProt

Q8WY22

Expression Region

1-251

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSL FGEDNVRAAQKFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSS SPARALLLVGVVLLAYWFLSLTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGE PENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNR VLESLDRSKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF4 (R239) polyclonal antibody
orb642537-01 25 µL

ATF4 (R239) polyclonal antibody

Sign In for Pricing
View Details
ATF4 (R239) polyclonal antibody
orb642537-02 50 μL

ATF4 (R239) polyclonal antibody

Sign In for Pricing
View Details
ATF4 (R239) polyclonal antibody
orb642537-03 100 µL

ATF4 (R239) polyclonal antibody

Sign In for Pricing
View Details
ATF4 (R239) polyclonal antibody
orb642537-04 200 µL

ATF4 (R239) polyclonal antibody

Sign In for Pricing
View Details
Phkg2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4529205 3x 1.0 µg

Phkg2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Amigo1-set siRNA/shRNA/RNAi Lentivector (Rat)
11837096 4x 500 ng

Amigo1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details