Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Derlin-1 (Derl1)

This Recombinant Mouse Derlin-1 (Derl1) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Derlin-1, Degradation in endoplasmic reticulum protein 1, Der1-like protein 1

UniProt

Q99J56

Expression Region

1-251

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATF YFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLFNWICIVITGLAMDMQL LMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH NWGQGFRLGDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morg1/WDR83 Rabbit Polyclonal Antibody
orb18050 100 µg

Morg1/WDR83 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-​Carbamoyl-​DL-​aspartic acid
T5284-01 500 mg

N-​Carbamoyl-​DL-​aspartic acid

Sign In for Pricing
View Details
N-​Carbamoyl-​DL-​aspartic acid
T5284-02 1 mL - 10 mM (in DMSO)

N-​Carbamoyl-​DL-​aspartic acid

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin, pan Antibody (MonoPoly/7249R) [mFluor Violet 450 SE]
NBP3-14199MFV450 0.1 mL

Rabbit Monoclonal Cytokeratin, pan Antibody (MonoPoly/7249R) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Mouse Monoclonal Mind Bomb 1/MIB1 Antibody (6A9C9)
NBP2-61864-0.025mL 0.025 mL

Mouse Monoclonal Mind Bomb 1/MIB1 Antibody (6A9C9)

Sign In for Pricing
View Details
Dlx5 Recombinant Antibody, FITC Conjugated
bsm-62005R-FITC-01 20 µL

Dlx5 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details