Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Derlin-1 (Derl1)

This Recombinant Mouse Derlin-1 (Derl1) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Derlin-1, Degradation in endoplasmic reticulum protein 1, Der1-like protein 1

UniProt

Q99J56

Expression Region

1-251

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATF YFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLFNWICIVITGLAMDMQL LMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH NWGQGFRLGDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Paraoxonase (PON) ELISA Kit
EIA06179Ch 1 Kit

Chicken Paraoxonase (PON) ELISA Kit

Sign In for Pricing
View Details
Vinyl butyrate
sc-224367 5 mL

Vinyl butyrate

Sign In for Pricing
View Details
TLR1 (Toll Like Receptor 1, CD281) discontinued see T8050-02A
T8050-02C 100 µg

TLR1 (Toll Like Receptor 1, CD281) discontinued see T8050-02A

Sign In for Pricing
View Details
MRP4 Rabbit pAb
E53P03942 100 µL

MRP4 Rabbit pAb

Sign In for Pricing
View Details
STF 632-DIA 315-B7527 AC Signs
223003 Card of 1 Pictogram(s)

STF 632-DIA 315-B7527 AC Signs

Sign In for Pricing
View Details
TERF2IP polyclonal antibody
orb642059-01 50 μL

TERF2IP polyclonal antibody

Sign In for Pricing
View Details