Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. ATP synthase subunit a (atpB)

This Recombinant Nostoc sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P12404

Expression Region

1-251

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNFLNFYSVPLAELEVGKHLYWQIGNLKLHGQVFLTSWFVIGVLVLASVAASSNVKRIP SGIQNLLEYALEFIRDLAKNQIGEKEYRPWVPFVGTLFLFIFVSNWSGALVPFKLIHLPE GELTAPTSDINTTVALALLTSLAYFYAGFSKKGLGYFGNYVQPVSFMLPFKIIEDFTKPL SLSFRLFGNILADELVVGVLVLLVPLFVPLPVMALGLFTSAIQALIFATLAAAYIGEAME DHHGEEHEEHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FES Antibody
8C10294-AAT 50 µg

FES Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS502431 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130M-01 20 Tests

Elab Fluor® 647 Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130M-02 100 Tests

Elab Fluor® 647 Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details
LAF4 (AFF3) (NM_002285) Human Over-expression Lysate
LY419437 100 µg

LAF4 (AFF3) (NM_002285) Human Over-expression Lysate

Sign In for Pricing
View Details