Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. ATP synthase subunit a (atpB)

This Recombinant Nostoc sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P12404

Expression Region

1-251

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNFLNFYSVPLAELEVGKHLYWQIGNLKLHGQVFLTSWFVIGVLVLASVAASSNVKRIP SGIQNLLEYALEFIRDLAKNQIGEKEYRPWVPFVGTLFLFIFVSNWSGALVPFKLIHLPE GELTAPTSDINTTVALALLTSLAYFYAGFSKKGLGYFGNYVQPVSFMLPFKIIEDFTKPL SLSFRLFGNILADELVVGVLVLLVPLFVPLPVMALGLFTSAIQALIFATLAAAYIGEAME DHHGEEHEEHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3Beta,5Alpha)-Cholesta-8,14-dien-3-ol
TRC-C431525-50MG 50 mg

(3Beta,5Alpha)-Cholesta-8,14-dien-3-ol

Sign In for Pricing
View Details
N1,N3,N5-Tris[3-(Didodecylamino)propyl]-1,3,5-benzenetricarboxamide-D18
TRC-D458951-10MG 10 mg

N1,N3,N5-Tris[3-(Didodecylamino)propyl]-1,3,5-benzenetricarboxamide-D18

Sign In for Pricing
View Details
DNAJA2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C4]
TA501688BM 100 µL

DNAJA2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C4]

Sign In for Pricing
View Details
Rat AMH (Anti-Mullerian Hormone) ELISA Kit
E-EL-R3022-01 24 Tests

Rat AMH (Anti-Mullerian Hormone) ELISA Kit

Sign In for Pricing
View Details
Rat AMH (Anti-Mullerian Hormone) ELISA Kit
E-EL-R3022-02 48 Tests

Rat AMH (Anti-Mullerian Hormone) ELISA Kit

Sign In for Pricing
View Details
Rat AMH (Anti-Mullerian Hormone) ELISA Kit
E-EL-R3022-03 96 Tests

Rat AMH (Anti-Mullerian Hormone) ELISA Kit

Sign In for Pricing
View Details