Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. ATP synthase subunit a (atpB)

This Recombinant Nostoc sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P12404

Expression Region

1-251

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNFLNFYSVPLAELEVGKHLYWQIGNLKLHGQVFLTSWFVIGVLVLASVAASSNVKRIP SGIQNLLEYALEFIRDLAKNQIGEKEYRPWVPFVGTLFLFIFVSNWSGALVPFKLIHLPE GELTAPTSDINTTVALALLTSLAYFYAGFSKKGLGYFGNYVQPVSFMLPFKIIEDFTKPL SLSFRLFGNILADELVVGVLVLLVPLFVPLPVMALGLFTSAIQALIFATLAAAYIGEAME DHHGEEHEEHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LILRB4 Antibody
OC-564-01 50 μL

LILRB4 Antibody

Sign In for Pricing
View Details
LILRB4 Antibody
OC-564-02 100 µL

LILRB4 Antibody

Sign In for Pricing
View Details
LILRB4 Antibody
OC-564-03 1 mL

LILRB4 Antibody

Sign In for Pricing
View Details
Lanosterol (Technical Grade)
TRC-L174580-1MG 1 mg

Lanosterol (Technical Grade)

Sign In for Pricing
View Details
4-Nitrobenzoyl chloride
TRC-N493605-50G 50 g

4-Nitrobenzoyl chloride

Sign In for Pricing
View Details
ANGPTL3 Polyclonal Antibody
E-AB-40537-01 25 µL

ANGPTL3 Polyclonal Antibody

Sign In for Pricing
View Details