Recombinant Oedogonium cardiacum ATP synthase subunit a, chloroplastic (atpI)
This Recombinant Oedogonium cardiacum ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-252.
Product Specifications
Product Name Alternative
ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV
UniProt
B2X1U8
Expression Region
1-252
Origin
Oedogonium cardiacum (Filamentous green alga)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MIEHIFIFNNSTSLSNPVFDISEVAVGQHLYWQIGDYQLHGQVLITSWIVLGGVIIFTLL ANSDLKPLPVGLQNFTELVTEFIRDLAKTQIGEEEYLKWVPFLGTIFIFVFVSNWAGALL PWRLIELPNGELAAPTNDINTTVSLALLTSVSYFYAGIRKKGLGYFKRYIQPVVFLLPLN VLEDFSKPLSLSFRLFGNILADELIVGVLVALVPLFVPIPLMLLGVFTSAIQALVFATLA GAYIGESIEDHH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400204-100 1x 100 µL
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC140017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401505-100 1x 100 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details