Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clc-like protein 2 (clc-2)

This Recombinant Clc-like protein 2 (clc-2) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Clc-like protein 2

UniProt

Q11085

Expression Region

1-252

Origin

Caenorhabditis elegans

Field of Research

Neuroscience; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQAVSYAILVLTIIAFLLTAAALCTPAWQVVYAREIRQWVQSGLWLSCQTRPNGMYSCT YTFSHDDFNTYFSDEVSGFRTPSFYPWQRTLFHIYLISQAFAMLSLISFCVSVSHKESKM PNILRSVFLVLAAVIAFGCLIAFAVYSYMVEYRFFHVSVSGIYEKHRGYSWYIALTGAFV YLVAIILSVVHVLLQARNSNTTMSRQNINSSLQSDFFEYQYHPNRSMESFEDRFAMRTLP PVPRQEKKTTVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matrix Metalloproteinase 8 (MMP8) Rabbit anti-Human Polyclonal Antibody
GWB-52223C 0.05 mg

Matrix Metalloproteinase 8 (MMP8) Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
Rxra 3'UTR Luciferase Stable Cell Line
TU219860 1.0 mL

Rxra 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MUM1 (D-11) Alexa Fluor® 546
sc-514332 AF546 200 µg/mL

MUM1 (D-11) Alexa Fluor® 546

Sign In for Pricing
View Details
Rat Maturation promoting factor ELISA Kit
MBS722032-01 48 Well

Rat Maturation promoting factor ELISA Kit

Sign In for Pricing
View Details
Rat Maturation promoting factor ELISA Kit
MBS722032-02 96 Well

Rat Maturation promoting factor ELISA Kit

Sign In for Pricing
View Details
Rat Maturation promoting factor ELISA Kit
MBS722032-03 5x 96 Well

Rat Maturation promoting factor ELISA Kit

Sign In for Pricing
View Details