Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clc-like protein 2 (clc-2)

This Recombinant Clc-like protein 2 (clc-2) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Clc-like protein 2

UniProt

Q11085

Expression Region

1-252

Origin

Caenorhabditis elegans

Field of Research

Neuroscience; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQAVSYAILVLTIIAFLLTAAALCTPAWQVVYAREIRQWVQSGLWLSCQTRPNGMYSCT YTFSHDDFNTYFSDEVSGFRTPSFYPWQRTLFHIYLISQAFAMLSLISFCVSVSHKESKM PNILRSVFLVLAAVIAFGCLIAFAVYSYMVEYRFFHVSVSGIYEKHRGYSWYIALTGAFV YLVAIILSVVHVLLQARNSNTTMSRQNINSSLQSDFFEYQYHPNRSMESFEDRFAMRTLP PVPRQEKKTTVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMIQ6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0187005 3x 1.0 µg

BMIQ6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-Myeloid Cell Marker Antibody Clone SPM298, Unconjugated-100ug
MSM1X-61-P1 100ug

Anti-Myeloid Cell Marker Antibody Clone SPM298, Unconjugated-100ug

Sign In for Pricing
View Details
Goat B cell CLL/lymphoma 9 like protein (BCL9L) ELISA Kit
GTR10355923 96 Well

Goat B cell CLL/lymphoma 9 like protein (BCL9L) ELISA Kit

Sign In for Pricing
View Details
SH3D19 Antibody
CSB-PA711356LA01HU-01 50 µg

SH3D19 Antibody

Sign In for Pricing
View Details
SH3D19 Antibody
CSB-PA711356LA01HU-02 100 µg

SH3D19 Antibody

Sign In for Pricing
View Details
Rabbit Anti-B. pertussis Fimbrae 2/3 (Fim2/3) IgM ELISA kit, 96 tests, Quantitative
960-395-FIM 1 Kit

Rabbit Anti-B. pertussis Fimbrae 2/3 (Fim2/3) IgM ELISA kit, 96 tests, Quantitative

Sign In for Pricing
View Details