Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clc-like protein 2 (clc-2)

This Recombinant Clc-like protein 2 (clc-2) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Clc-like protein 2

UniProt

Q11085

Expression Region

1-252

Origin

Caenorhabditis elegans

Field of Research

Neuroscience; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQAVSYAILVLTIIAFLLTAAALCTPAWQVVYAREIRQWVQSGLWLSCQTRPNGMYSCT YTFSHDDFNTYFSDEVSGFRTPSFYPWQRTLFHIYLISQAFAMLSLISFCVSVSHKESKM PNILRSVFLVLAAVIAFGCLIAFAVYSYMVEYRFFHVSVSGIYEKHRGYSWYIALTGAFV YLVAIILSVVHVLLQARNSNTTMSRQNINSSLQSDFFEYQYHPNRSMESFEDRFAMRTLP PVPRQEKKTTVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N4bp2l1 (NM_001035222) Rat Tagged Lenti ORF Clone
RR212460L3 10 µg

N4bp2l1 (NM_001035222) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Trim69 Pre-designed siRNA Set B
SI115251B 1 Each

Mouse Trim69 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Anti EGR1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200ul
IRBAMLEGR1AP299200UL 200 µL

Rabbit Anti EGR1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200ul

Sign In for Pricing
View Details
LIF Antibody
MBS7117356-01 0.05 mg

LIF Antibody

Sign In for Pricing
View Details
LIF Antibody
MBS7117356-02 0.1 mg

LIF Antibody

Sign In for Pricing
View Details
LIF Antibody
MBS7117356-03 5x 0.1 mg

LIF Antibody

Sign In for Pricing
View Details