Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus acidocaldarius Cobalamin synthase (cobS)

This Recombinant Sulfolobus acidocaldarius Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q4JBK2

Expression Region

1-252

Origin

Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRILKAILGQLSFFTIIPSPSASLEEIAEFSFISPLMVGIITGIIDWFVVLLGIRLIGS LGALLLIPTVEIIRGFHHLDGLLDMGDALMVGKERRPQVLHDLQTGSGAIGLFLVYFSIF LIATLNLNVSNLWFFLPSEVLARASAISLLGLMKPIPGSYLGKVFHDKMRDKLFSIKFLL VQVFAILFSSPVLILAYVILLLVFYLMAKLVFDGMSGDIVGAIITLSFPIYLLVAEKTCY HYFIFQYSLTLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Immunoglobulin E (IgE) Antibody (FITC)
abx139560 0.1 mg

Immunoglobulin E (IgE) Antibody (FITC)

Sign In for Pricing
View Details
Evi-1 (H-8) Alexa Fluor® 680
sc-515456 AF680 200 µg/mL

Evi-1 (H-8) Alexa Fluor® 680

Sign In for Pricing
View Details
KIFC3 Protein Vector (Mouse) (pPM-C-His)
PV194381 500 ng

KIFC3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Cdan1 ORF Vector (Mouse) (pORF)
ORF040931 1.0 µg DNA

Cdan1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MRPL9 Antibody - C-terminal region
ARP67672_P050-25UL 25 µL

MRPL9 Antibody - C-terminal region

Sign In for Pricing
View Details
3-Oxotirucalla-7,24-dien-21-oic acid
TN2979-01 5 mg

3-Oxotirucalla-7,24-dien-21-oic acid

Sign In for Pricing
View Details