Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus islandicus Cobalamin synthase (cobS)

This Recombinant Sulfolobus islandicus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C3NMG6

Expression Region

1-253

Origin

Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLKGVLALFSFFTAIPIKSNASLEEIAEYSYISPLIIGISLALIESAVYVLLYRILEAL AGIVLLGVVELLRGFNHLDGLLDLGDALMIKGDRERKIKALKDVEIGSGGIGLLLVYLSI QIVALLKLGFSFYTIFHLISSNVLSMTIGLYILSTISPIPESNLGKIFHNKLKGKSTVLL LELIPFISLYNIIVFLVFYMIMHKICRSLGGSSGDIAGASITLSFPLFLLTNEITNLNYS LLSILCYLFLHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Smooth muscle
CS502458 5x 5 µm

Frozen Tissue Sections, Smooth muscle

Sign In for Pricing
View Details
TCEB2 Recombinant Rabbit Monoclonal Antibody [JE65-72]
HA721002 100 µL

TCEB2 Recombinant Rabbit Monoclonal Antibody [JE65-72]

Sign In for Pricing
View Details
RAB34 (NM_031934) Human Over-expression Lysate
LC403132 20 µg

RAB34 (NM_031934) Human Over-expression Lysate

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 alpha (CCL20) Human Gene Knockout Kit (CRISPR)
KN204691 1 Kit

Macrophage Inflammatory Protein 3 alpha (CCL20) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 488-conjugated Vinculin Monoclonal Antibody
AN00297L-01 25 µL

Elab Fluor® 488-conjugated Vinculin Monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 488-conjugated Vinculin Monoclonal Antibody
AN00297L-02 100 µL

Elab Fluor® 488-conjugated Vinculin Monoclonal Antibody

Sign In for Pricing
View Details