Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus islandicus Cobalamin synthase (cobS)

This Recombinant Sulfolobus islandicus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C3NMG6

Expression Region

1-253

Origin

Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLKGVLALFSFFTAIPIKSNASLEEIAEYSYISPLIIGISLALIESAVYVLLYRILEAL AGIVLLGVVELLRGFNHLDGLLDLGDALMIKGDRERKIKALKDVEIGSGGIGLLLVYLSI QIVALLKLGFSFYTIFHLISSNVLSMTIGLYILSTISPIPESNLGKIFHNKLKGKSTVLL LELIPFISLYNIIVFLVFYMIMHKICRSLGGSSGDIAGASITLSFPLFLLTNEITNLNYS LLSILCYLFLHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chenodeoxycholic Acid 24-Acyl-Beta-D-glucuronide Allyl Ester
TRC-C291915-25MG 25 mg

Chenodeoxycholic Acid 24-Acyl-Beta-D-glucuronide Allyl Ester

Sign In for Pricing
View Details
LC3B Recombinant Chimeric Antibody Antibody
HA601532 100 µL

LC3B Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Human Osteoprotegerin / TNFRSF11B, C-His Tag
HA210977-01 Inquire

Human Osteoprotegerin / TNFRSF11B, C-His Tag

Sign In for Pricing
View Details
Human Osteoprotegerin / TNFRSF11B, C-His Tag
HA210977-02 50 µg

Human Osteoprotegerin / TNFRSF11B, C-His Tag

Sign In for Pricing
View Details
Human Osteoprotegerin / TNFRSF11B, C-His Tag
HA210977-03 100 µg

Human Osteoprotegerin / TNFRSF11B, C-His Tag

Sign In for Pricing
View Details
Human TBK1 activation kit by CRISPRa
GA109243 1 Kit

Human TBK1 activation kit by CRISPRa

Sign In for Pricing
View Details