Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Transmembrane protein 69 (tmem69)

This Recombinant Xenopus tropicalis Transmembrane protein 69 (tmem69) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Transmembrane protein 69

UniProt

Q0V9J0

Expression Region

1-253

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYLRRCLPLAQQITLLNQPAAPVYSICRQRLFSTSSRSFTKTYLFTLDRPILQSTTSTL SGQHKIHTSAHHFKKRKIQEETQKHELDLLRYDIKALKDAPKPALYLGLAGLIPFVSAPL LMNVTGCYYPEVAFAQVAYGASILSFLGGVRWGFAIPENSPAKPDWMNLTNSTVPALLAW LALLFRDNITEAAVLVIMGLGIALHYDLALLPTYPSWFKALRAILTVVAVFSLVGSLINS SVYPHKSLVSQEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-500 1x 500 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-500 1x 500 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF405S conjugate, 0.1mg/mL
BNC042066-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF647 conjugate, 0.1mg/mL
BNC470637-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details