Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine CD151 antigen (CD151)

This Recombinant Bovine CD151 antigen (CD151) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

CD151 antigen, CD_antigen= CD151

UniProt

Q3ZBH3

Expression Region

1-253

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEFGEKSTTCGTVCLKYLLFTFNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT AYILVVAGIVVMVTGALGCCATFKERRNLLRLYFGLLLIIFLLEIIAGALAYIYYQQLNA ELKENLKDTMTRRYHQPGHEGVTSAVDKLQQEFHCCGSNNSRDWQDSEWIHSGEAGGRVV PDSCCKTVVPGCGRRDHASNIYKVEGGCITKLETFIQEHLRIIGAVGLGIACVQVFGMLF TCCLYKSLKLEHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-USH1C
ARP96739_P050 100 µL

Anti-USH1C

Sign In for Pricing
View Details
Cathepsin L, human recombinant
1135-1000 1 mg

Cathepsin L, human recombinant

Sign In for Pricing
View Details
Phospho-p63 (Ser160+Ser162) Polyclonal Antibody, FITC Conjugated
bs-3716R-FITC 100 µL

Phospho-p63 (Ser160+Ser162) Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Actin Regulatory Protein CAPG (CAPG) Rabbit Polyclonal Antibody
TA392698 100 µL

Actin Regulatory Protein CAPG (CAPG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF3E Human qPCR Template Standard (NM_001568)
HK202747 1 Kit

EIF3E Human qPCR Template Standard (NM_001568)

Sign In for Pricing
View Details
caspase-8 Lentiviral Activation Particles (m)
sc-419469-LAC 200 µL

caspase-8 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details