Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine CD151 antigen (CD151)

This Recombinant Bovine CD151 antigen (CD151) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

CD151 antigen, CD_antigen= CD151

UniProt

Q3ZBH3

Expression Region

1-253

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEFGEKSTTCGTVCLKYLLFTFNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT AYILVVAGIVVMVTGALGCCATFKERRNLLRLYFGLLLIIFLLEIIAGALAYIYYQQLNA ELKENLKDTMTRRYHQPGHEGVTSAVDKLQQEFHCCGSNNSRDWQDSEWIHSGEAGGRVV PDSCCKTVVPGCGRRDHASNIYKVEGGCITKLETFIQEHLRIIGAVGLGIACVQVFGMLF TCCLYKSLKLEHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit
EH25341 96 Tests

Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Bovine Total Cholesterol (TC) ELISA Kit
CK-bio-26464-01 48 Tests

Bovine Total Cholesterol (TC) ELISA Kit

Sign In for Pricing
View Details
Bovine Total Cholesterol (TC) ELISA Kit
CK-bio-26464-02 96 Tests

Bovine Total Cholesterol (TC) ELISA Kit

Sign In for Pricing
View Details
Protein A Agarose Resin (4%)
abx291361-01 5 mL

Protein A Agarose Resin (4%)

Sign In for Pricing
View Details
Protein A Agarose Resin (4%)
abx291361-02 25 mL

Protein A Agarose Resin (4%)

Sign In for Pricing
View Details
Protein A Agarose Resin (4%)
abx291361-03 500 mL

Protein A Agarose Resin (4%)

Sign In for Pricing
View Details