Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Motility protein A (motA)

This Recombinant Rhodobacter sphaeroides Motility protein A (motA) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Motility protein A, Chemotaxis protein MotA

UniProt

Q53174

Expression Region

1-253

Origin

Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIAAAIGLIGAIVMVVGSMIYAGGVAPFVDIPSLVIVVAGTAFIVLAMKPLPVFLGHFK AMMKVFKPSRFDMNEVISTMVELSNLARKDGIMALEGKAVPDAFFEKGLQLLVDGTDEAK LVKQLKYEIKAMKARHEAYQGAVKAWIDIGPAMGMVGTLIGLVLMLGNMSDPKSIGPAMA VALLTTLYGALMANVIFAPILNKLEGYSADEVTYRELVIEGLRGIARGESARMIEDQMVC ALDRKQQMKRKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-100 1x 100 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-500 1x 500 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details