Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Claudin domain-containing protein 1 (CLDND1)

This Recombinant Pongo abelii Claudin domain-containing protein 1 (CLDND1) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Claudin domain-containing protein 1

UniProt

Q5RDV7

Expression Region

1-253

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEAD EKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFV DPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLA GLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTN RKEYTLMKAYRVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cyp4f16 activation kit by CRISPRa
GA208425 1 Kit

Mouse Cyp4f16 activation kit by CRISPRa

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF640R conjugate, 0.1mg/mL
BNC403124-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Laminin 2 alpha (LAMA2) Human Gene Knockout Kit (CRISPR)
KN417136 1 Kit

Laminin 2 alpha (LAMA2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UROS Human Gene Knockout Kit (CRISPR)
KN400385 1 Kit

UROS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IFluor® 450 succinimidyl ester
1026-AAT 1 mg

IFluor® 450 succinimidyl ester

Sign In for Pricing
View Details
MAFF Rabbit Polyclonal Antibody
AP17542PU-N 400 µL

MAFF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details