Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Claudin domain-containing protein 1 (CLDND1)

This Recombinant Pongo abelii Claudin domain-containing protein 1 (CLDND1) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Claudin domain-containing protein 1

UniProt

Q5RDV7

Expression Region

1-253

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEAD EKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFV DPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLA GLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTN RKEYTLMKAYRVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Bovine IgG, Fc Specific Antibody
HAF-412-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Bovine IgG, Fc Specific Antibody

Sign In for Pricing
View Details
TRPM7 Human Knockdown Lysate
LY300457 100 µg

TRPM7 Human Knockdown Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR560534 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
C8 Ceramide
SIH-499-5MG 5 mg

C8 Ceramide

Sign In for Pricing
View Details
ZNF789 (NM_213603) Human Over-expression Lysate
LC403881 20 µg

ZNF789 (NM_213603) Human Over-expression Lysate

Sign In for Pricing
View Details
Scrn3 Mouse Gene Knockout Kit (CRISPR)
KN515405 1 Kit

Scrn3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details