Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Tetraspanin-3 (TSPAN3)

This Recombinant Pongo abelii Tetraspanin-3 (TSPAN3) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Tetraspanin-3, Tspan-3

UniProt

Q5RE11

Expression Region

1-253

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVVIIAV GALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQ KVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETAS NCNGSLAHPSDLYAEGCEALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRD PAYELLITGGTYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC ε CRISPR/Cas9 KO Plasmid (h)
sc-400358 20 µg

PKC ε CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
KRTAP21-3 (NM_001164435) Human Untagged Clone
SC326657 10 µg

KRTAP21-3 (NM_001164435) Human Untagged Clone

Sign In for Pricing
View Details
Tebipenem pivoxil hydrochloride
T75288-01 100 mg

Tebipenem pivoxil hydrochloride

Sign In for Pricing
View Details
Tebipenem pivoxil hydrochloride
T75288-02 25 mg

Tebipenem pivoxil hydrochloride

Sign In for Pricing
View Details
Tebipenem pivoxil hydrochloride
T75288-03 50 mg

Tebipenem pivoxil hydrochloride

Sign In for Pricing
View Details
Mouse EphB4 Recombinant Protein
PROTP54761-01 10 µg

Mouse EphB4 Recombinant Protein

Sign In for Pricing
View Details