Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse BRI3-binding protein (Bri3bp)

This Recombinant Mouse BRI3-binding protein (Bri3bp) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

BRI3-binding protein, I3-binding protein

UniProt

Q8BXV2

Expression Region

1-253

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGARASQEPRTRVRAGLRVLLPVLLLALLLLALVAPGAQGARGRGAADKNSHRRATSSFS QSVSSLFGEDNVRAAQKLLSRLTERFVQGVDMFLETLWKVWMELLEVLGLDVSNLSQYFS PASVSNSPTRALVLVGVVLLAYWFLSLTLGFTFSLLHLVFGRFFWLVRVILFSMSCVYIL HKYEGEPEHAVLPLCVVVAIYFMTGPMGYWRGSPGGLCSPSVEEKLEHLENQVRLLNIRL NRVLENLDRSKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MALT-1 (MT1/410), CF647 conjugate, 0.1mg/mL
BNC470410-500 1x 500 µL

MALT-1 (MT1/410), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Spleen
CS707967 5x 5 µm

Tissue FFPE Sections, Spleen

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-1010-01 50 μL

DNAJB1 Antibody

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-1010-02 100 µL

DNAJB1 Antibody

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-1010-03 1 mL

DNAJB1 Antibody

Sign In for Pricing
View Details
Syntaxin 1a (STX1A) Rabbit Polyclonal Antibody
TA382167 100 µL

Syntaxin 1a (STX1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details