Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse BRI3-binding protein (Bri3bp)

This Recombinant Mouse BRI3-binding protein (Bri3bp) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

BRI3-binding protein, I3-binding protein

UniProt

Q8BXV2

Expression Region

1-253

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGARASQEPRTRVRAGLRVLLPVLLLALLLLALVAPGAQGARGRGAADKNSHRRATSSFS QSVSSLFGEDNVRAAQKLLSRLTERFVQGVDMFLETLWKVWMELLEVLGLDVSNLSQYFS PASVSNSPTRALVLVGVVLLAYWFLSLTLGFTFSLLHLVFGRFFWLVRVILFSMSCVYIL HKYEGEPEHAVLPLCVVVAIYFMTGPMGYWRGSPGGLCSPSVEEKLEHLENQVRLLNIRL NRVLENLDRSKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynein light chain 1, cytoplasmic Polyclonal Conjugated Antibody
orb1617955 100 µL

Dynein light chain 1, cytoplasmic Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Syndecan 1 Rabbit Polyclonal Antibody
APRab00566-01 20 µL

Syndecan 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syndecan 1 Rabbit Polyclonal Antibody
APRab00566-02 50 µL

Syndecan 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syndecan 1 Rabbit Polyclonal Antibody
APRab00566-03 100 µL

Syndecan 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syndecan 1 Rabbit Polyclonal Antibody
APRab00566-04 200 µL

Syndecan 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adam26b Protein Vector (Rat) (pPM-C-HA)
PV252200 500 ng

Adam26b Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details